PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678440513
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 203aa    MW: 21205.9 Da    PI: 5.0839
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678440513genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70283.93.9e-2673127100154
     DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                le  s+P+evsseavfrcvrv++ ddge++laYqtav+i GhvfkGiLydqG+++
  678440513  73 LELGSFPSEVSSEAVFRCVRVTANDDGEDKLAYQTAVKICGHVFKGILYDQGVDS 127
                45566************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.9E-2368126IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016241.4E-2678125IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MLSASPDKAF VKDHLLFPSL VTSLLLLLLP FLLLSLHFKL SQPSFNSNSI AESISGSLAS  60
RDHSLVFSLF VGLELGSFPS EVSSEAVFRC VRVTANDDGE DKLAYQTAVK ICGHVFKGIL  120
YDQGVDSQQY LAGETSSGGG GSVSAGGAQQ LNLIPGTTSA TATSAPPNTS AAPGTSPFLD  180
PSLYPTPINS FIAGNQFFPS SRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090405.11e-45PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD402e-34SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLS8DYK72e-48S8DYK7_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0007s13610.12e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1829424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.14e-31Lateral root primordium (LRP) protein-related